Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05456.1.g00030.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 817aa    MW: 90113.5 Da    PI: 10.735
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 
                                   Fl+k+y++++d+++++++sws+++nsfvv+d++ fa+ +Lp++Fkh+nf+SFvRQLn+Y 199 FLTKTYDMVDDPTTDHVVSWSATNNSFVVWDPHAFATVMLPRHFKHNNFSSFVRQLNTYRH 259
                                   9********************999***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF467853.4E-24195267IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA: helix-turn-helix DNA-binding domain
SMARTSM004153.2E-32195267IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.5E-13199222IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.6E-21199265IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.5E-13237249IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.5E-13250262IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF005042.4E-9698807IPR022796Chlorophyll A-B binding protein
SuperFamilySSF1035111.05E-19699816IPR023329Chlorophyll a/b binding protein domain
Gene3DG3DSA:1.20.1620.107.9E-8715815No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B3e-161972572787Heat shock factor protein 1
5d5v_B3e-161972572787Heat shock factor protein 1
5d5v_D3e-161972572787Heat shock factor protein 1
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number